PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM01G11550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 489aa    MW: 54707.9 Da    PI: 5.0112
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM01G11550.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.34.5e-5191361128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGf FhP+d el+++yLkkk++g+k+e  e+i+evdiyk+ePwdLp+   v +++++w+fF+ rd+ky++g+r+nrat +gyWk+tgkd+++
  OGLUM01G11550.1   9 LPPGFGFHPKDTELISHYLKKKIHGQKIEY-EIIPEVDIYKHEPWDLPAkcDVPTQDNKWHFFAARDRKYPNGSRSNRATVAGYWKSTGKDRAI 101
                      79****************************.99***************5356667999************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +  +++++g+kktLvf++gr p+g++t+W+mhey +
  OGLUM01G11550.1 102 KM-GKQTIGTKKTLVFHEGRPPTGRRTEWIMHEYYI 136
                      *9.99*****************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.98E-593159IPR003441NAC domain
PROSITE profilePS5100555.5349159IPR003441NAC domain
PfamPF023651.0E-2410135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MESLRDMVLP PGFGFHPKDT ELISHYLKKK IHGQKIEYEI IPEVDIYKHE PWDLPAKCDV  60
PTQDNKWHFF AARDRKYPNG SRSNRATVAG YWKSTGKDRA IKMGKQTIGT KKTLVFHEGR  120
PPTGRRTEWI MHEYYIDERE CQACPDMKDA YVLCRITKRN DWIPGNGNEL DNSDPHPEPY  180
DAPPSVISTE QLNPAAEPVV GVEAAPVTVA EPDGVTTSAI TANIPSPSDD INLDDWLNEL  240
FDPFFDPEQS LASADLSPDE QNVESSNLGA LAPKVEQDYS SPNENVVDDT EYLLPEDVYN  300
ILHPGTDDFN MLQNPLDQYP IQYATDVWSG IQKEELWSPQ ANAEPSQSNE AADNGIIRRY  360
RSMKTPETSV PQFKGKTQAK MRVGINKMAT SSSESINQTI KFENSGRLVE HQKNQAHDVA  420
STKRSDAGKP STELSSNRGF LRGIRNAFAG CSDARWNMIL VAGFAIGVAV VALHIGQRLG  480
LSQRDQQHT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-45616212172Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281870.0AB028187.1 Oryza sativa mRNA for OsNAC8 protein, complete cds.
GenBankAK1028080.0AK102808.1 Oryza sativa Japonica Group cDNA clone:J033108J08, full insert sequence.
GenBankGU1203470.0GU120347.1 Oryza sativa Japonica Group clone KCS602B05 NAC8 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649784.10.0PREDICTED: NAC domain-containing protein 74
SwissprotQ7GCL70.0NAC74_ORYSJ; NAC domain-containing protein 74
TrEMBLA0A0D9Y6C20.0A0A0D9Y6C2_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g15640.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75603847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17260.13e-66NAC domain containing protein 86